PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G06330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 393aa    MW: 43224.1 Da    PI: 7.423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G06330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-1890135248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+WT eEde l + v q+G++ W+ Ia+ ++ gR +kqc++rw ++l
  LPERR07G06330.1  90 GPWTREEDEVLRNMVIQHGNRKWAEIAKSLP-GRIGKQCRERWINHL 135
                      89*****************************.************996 PP

2Myb_DNA-binding48.52e-15141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT eEd++l++a+k +G+  W++I+r++  gR+++++k++w+
  LPERR07G06330.1 141 KDVWTGEEDKILIEAHKIFGKS-WSAISRYLL-GRSENNIKNHWN 183
                      578*****************88.********9.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.42484139IPR017930Myb domain
SuperFamilySSF466892.91E-2986182IPR009057Homeodomain-like
SMARTSM007171.1E-1588137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2390138IPR009057Homeodomain-like
PfamPF002492.9E-1690135IPR001005SANT/Myb domain
CDDcd001675.18E-1691135No hitNo description
Gene3DG3DSA:1.10.10.608.7E-19139188IPR009057Homeodomain-like
PROSITE profilePS5129417.376140190IPR017930Myb domain
SMARTSM007172.5E-14140188IPR001005SANT/Myb domain
PfamPF002492.0E-13141183IPR001005SANT/Myb domain
CDDcd001676.42E-12144183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MEGDLTAATG NSFVNHEFLM TANNVSQRHF TSSTNAGDRT GMAPSSFVMS EWGQAAASYG  60
TVASNLVGAA MVCQQTQARG SNDKPPLING PWTREEDEVL RNMVIQHGNR KWAEIAKSLP  120
GRIGKQCRER WINHLHPDIK KDVWTGEEDK ILIEAHKIFG KSWSAISRYL LGRSENNIKN  180
HWNATARRLK SKRRLRQTSL LEDYIRSKPS ETIKTTPPLS GPAPFDNLEY NTGLISAGST  240
PAIQAPSFST PPELVAYTGV LNSATIPSQL ETLDLFRTPV LPKLSLNTDH EHRGDRYDLP  300
FSEGNIHFSG SYHSGGCQGS QPSYQSLYPP SSLAGSHVDG GRVAFDLQSS NQANAGCHYY  360
GEEGPNSFGK GVMNNNDIVG QFMNDSDQAK WIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-39851883106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-107PREDICTED: transcription factor RAX1-like
TrEMBLA0A0D9WWV00.0A0A0D9WWV0_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g12130.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-46myb domain protein 98